PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P25770_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bHLH
Protein Properties Length: 89aa    MW: 10227.7 Da    PI: 8.5173
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P25770_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.78.7e-0816551554
                            HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                     HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                            +iN+ +++L++llP++ + +  + s +  L++++ YIksL
  GSMUA_Achr10P25770_001 16 EINELISKLQSLLPESRRRSMSRASASKLLKETCSYIKSL 55
                            7**************767788889999************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.353155IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.4E-101572IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.88E-91579IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.6E-51655IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MPIEMSSRRS RITDEEINEL ISKLQSLLPE SRRRSMSRAS ASKLLKETCS YIKSLHREVD  60
DLSDRLSDLM STMDSNSPQA EIIRSILRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380994.11e-54PREDICTED: transcription factor ILI3-like
SwissprotQ6YUX02e-40ILI5_ORYSJ; Transcription factor ILI5
SwissprotA2X9L82e-40ILI5_ORYSI; Transcription factor ILI5
TrEMBLM0RLF11e-54M0RLF1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P25770_0014e-54(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92838145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.13e-14bHLH family protein